What is the CAS number for LL-37?

LL-37 is registered under CAS Registry Number 154947-66-7.

What is the molecular formula of LL-37?

The molecular formula of LL-37 is C205H340N60O53, with a molecular weight of 4493.27 g/mol.

How many amino acids does LL-37 contain?

LL-37 is a 37-amino-acid peptide. The single-letter sequence is LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES.

What's included with each LL-37 lot?

Every lot of LL-37 ships with a per-lot Certificate of Analysis (COA) from an independent US laboratory documenting ≥99.0% purity by HPLC and mass-spectrometry identity confirmation. The COA is QR-linked from the vial label.

How is LL-37 verified?

Each lot of LL-37 is independently verified at Chromate.org, a US analytical laboratory, with HPLC purity, mass-spectrometry identity, and heavy-metal screening. The per-lot Certificate of Analysis is published on this page and ships printed in every package.

Lyophilized LL-37 is shipped at ambient temperature in protective packaging. For long-term laboratory storage, refer to the per-lot Certificate of Analysis storage notes specific to the lot you receive.

ECM / tissue-repair research

LL-37

CAS 154947-66-7

5 mg per vial$89.00 / vialIn stock · 100 vials on hand

Quantity1–500 vials

× $89.00

First order? Code FIRST10 takes 10% off and is applied for you at checkout.

Bulk pricingPrice drops as you scale

Tap a tier to set quantity — auto-applies in cart · 100+ price holds to 500 per cart.

This lot is tested. Lot LL05-01162026-J · 99.926% purity by HPLC · Freedom DiagnosticsView the COA →
Ships free, no minimum. Order by 2 PM ET on a business day and it ships the same day.Shipping →
If a third-party lab disagrees with our COA, full refund plus $100.Guarantee →
Pay with PayPal. Bank and crypto orders ship when funds land.Payments →
Made in the USA. Synthesized in an ISO-7 cleanroom; a printed COA ships in the box.Facility →

Reselling, or buying at wholesale volume? See wholesale and white-label peptide supply.

Quality · Sourcing · Verification

Synthesized in our US-based ISO-7 certified cleanroom laboratory under cGMP-aligned procedures.
Secure facility with 24-hour CCTV cold-chain storage and time-locked chain-of-custody protocols.
Independently verified by Chromate.org — HPLC purity, mass-spec identity, and heavy-metal screening per lot.
Per-lot Certificate of Analysis published on this page; a printed copy ships inside every package.
US-domestic shipping only · free standard shipping on every order.

This product is for laboratory research use only. Not for human or veterinary use. Not a drug, supplement, or medical device.

Molecular data

CAS number: 154947-66-7
Mol. formula: C205H340N60O53
Mol. weight: 4493.27 g/mol
Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Purity: ≥ 99.0%
Lot number: Assigned at shipment

Certificate of Analysis

Independent third-party verified

Purity (HPLC): 99.926%
Batch: LL05-01162026-J
Laboratory: Freedom Diagnostics
Analyzed: Jan 21, 2026

Certificate of Analysis — LL-37 batch LL05-01162026-J

View full COA

Summary

CAS 154947-66-7 · 37 amino acids · 4493.27 g/mol · ≥99% by HPLC · from $89

37-residue human cathelicidin antimicrobial peptide studied in innate-immunity and wound-healing research.

Read the full LL-37 compound profile — mechanism, published research, and references →

Research context

Vandamme et al., Cell Immunol (2012).

Published research

Primary literature on this compound — trial design, endpoints and limitations. Summaries, not recommendations.

Browse the full study library

About LL-37

What is LL-37?: 37-residue human cathelicidin antimicrobial peptide studied in innate-immunity and wound-healing research.
What is the CAS number for LL-37?: LL-37 is registered under CAS Registry Number 154947-66-7.
What is the molecular formula of LL-37?: The molecular formula of LL-37 is C205H340N60O53, with a molecular weight of 4493.27 g/mol.
How many amino acids does LL-37 contain?: LL-37 is a 37-amino-acid peptide. The single-letter sequence is LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES.
What research context is LL-37 studied in?: Vandamme et al., Cell Immunol (2012).
What's included with each LL-37 lot?: Every lot of LL-37 ships with a per-lot Certificate of Analysis (COA) from an independent US laboratory documenting ≥99.0% purity by HPLC and mass-spectrometry identity confirmation. The COA is QR-linked from the vial label.
How is LL-37 verified?: Each lot of LL-37 is independently verified at Chromate.org, a US analytical laboratory, with HPLC purity, mass-spectrometry identity, and heavy-metal screening. The per-lot Certificate of Analysis is published on this page and ships printed in every package.
How is LL-37 stored?: Lyophilized LL-37 is shipped at ambient temperature in protective packaging. For long-term laboratory storage, refer to the per-lot Certificate of Analysis storage notes specific to the lot you receive.
Is LL-37 approved for human or veterinary use?: No. This product is for laboratory research use only. Not for human or veterinary use. Not a drug, supplement, or medical device. Customers certify research use at checkout per our Terms of Sale.

Research use only

This product is for laboratory research use only. Not for human or veterinary use. Not a drug, supplement, or medical device. By purchasing, customer certifies research use per our Terms of Sale.